PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.250310.1
Common NameCsa_2G297220
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family WRKY
Protein Properties Length: 247aa    MW: 28422.8 Da    PI: 9.8469
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.250310.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.78.5e-32169227159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+vk++++prsYYrCt+ +C+vkk+ver aedp++v++tYeg+H h+
  Cucsa.250310.1 169 LDDGYKWRKYGQKVVKNTQHPRSYYRCTQDHCRVKKRVERLAEDPRMVITTYEGRHVHS 227
                     59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.7E-33154227IPR003657WRKY domain
SuperFamilySSF1182905.89E-28161228IPR003657WRKY domain
PROSITE profilePS5081129.126164229IPR003657WRKY domain
SMARTSM007742.7E-35169228IPR003657WRKY domain
PfamPF031061.7E-24170226IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MGSKSQVMLN PQALLEDHQE VTPNSQMGFF NFPSNLTFFQ LPSIPQTHSP SPSFDPPNFS  60
TSNNNTNNNN NSNNLSETLL SSSILPLKSS ISYELAPQHL LSLQTSTPNL WPWGEIGERL  120
LMNGKRSNNN ENYNNQLGVS KMKMKKMKGR RKVREPRFSF KTMSDVDVLD DGYKWRKYGQ  180
KVVKNTQHPR SYYRCTQDHC RVKKRVERLA EDPRMVITTY EGRHVHSPSH DSEDSEAQTH  240
LNNFFW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-26161226974Probable WRKY transcription factor 4
2lex_A4e-26161226974Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU9840380.0GU984038.1 Cucumis sativus WRKY protein (WRKY53) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004148455.10.0PREDICTED: probable WRKY transcription factor 13
TrEMBLA0A0A0LJY40.0A0A0A0LJY4_CUCSA; Uncharacterized protein
STRINGVIT_07s0031g01840.t014e-92(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40793361
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39410.14e-54WRKY DNA-binding protein 13
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Ling J, et al.
    Genome-wide analysis of WRKY gene family in Cucumis sativus.
    BMC Genomics, 2011. 12: p. 471
    [PMID:21955985]
  4. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]